Vesugen: A Khavinson Tripeptide Bioregulator (Lys-Glu-Asp)

Research summary. Vesugen is a short tripeptide (Lys-Glu-Asp; KED) developed within the Khavinson "peptide bioregulator" research programme in St. Petersburg, Russia. Within that framework, it is described as a vascular-tropic bioregulator with reported effects on endothelial function, atherosclerotic-process markers, and downstream consequences such as neuroprotection in the central nervous system. As with the wider Khavinson bioregulator family, the supporting literature is concentrated within the originating Russian research programme, and independent Western validation of the underlying mechanistic model is limited. Researchers should treat reported effects as hypothesis-generating.

Molecular profile

• Sequence: Lys-Glu-Asp (KED; H-Lys-Glu-Asp-OH)
• Molecular formula: C₁₅H₂₆N₄O₈
• Molecular weight: ~390.4 g/mol
• PubChem CID: 87571363
• Class: Khavinson short-chain peptide bioregulator (cytomedine family)
• Reported tissue tropism: Vascular endothelium

Mechanism of action

The mechanistic framework proposed within the Khavinson programme for short bioregulators including Vesugen emphasises:

• Direct DNA/chromatin interaction. Khavinson and colleagues have proposed that short peptides interact with promoter regions and modulate transcription of tissue-specific genes.
• Endothelial gene expression. Vesugen has been reported to modulate expression of vascular-relevant genes including endothelin-1 and sirtuin-1 in research-programme reports.
• Sirtuin-1 activation framing. Some reports describe Vesugen-associated changes in SIRT1 expression, with the suggestion of calorie-restriction-mimetic effects.
• Limited independent receptor or signalling characterisation. As with the wider bioregulator class, the standard pharmacology framework (receptor identification, structure–activity relationships, independent in vitro reproductions) is not well established outside the originating programme.

Preclinical and applied research

Endothelial and atherosclerotic markers. Within the Khavinson research programme, Vesugen has been reported to influence endothelial-function markers and to reduce atherosclerotic-process indicators in animal and cell-culture models.

Central nervous system. Reported neuroprotective effects in CNS contexts are described within the same programme, with proposed relevance to memory, synaptic plasticity, and hypoxia tolerance — framed as secondary to vascular effects in the CNS microvasculature.

Sirtuin-1 and calorie-restriction framing. Some reports describe Vesugen as a sirtuin-1 modulator, with associated framing as a calorie-restriction-mimetic intervention. This framing should be evaluated against the broader sirtuin literature and the specific evidence quality of the underlying experiments.

Independent validation. Independent Western preclinical replication of these specific findings is limited.

Current research status

Vesugen is not approved by any major Western regulator (FDA, EMA, MHRA) for any indication. It is supplied as a research-grade peptide where available and is not intended for self-administration. Researchers working with this peptide should approach it as an investigational research material, recognise the limited independent literature, and design experiments with appropriate vehicle controls and orthogonal endpoints.

Key takeaways for researchers

• Vesugen is a Lys-Glu-Asp (KED) tripeptide developed within the Khavinson bioregulator research programme.
• Within that framework, it is described as vascular-tropic with reported effects on endothelin-1 and sirtuin-1 expression and downstream CNS-protective effects.
• Supporting literature is concentrated in the originating Russian research programme; independent Western validation of the underlying mechanistic model is limited.
• It is not FDA-approved and is supplied as a research-grade peptide for laboratory use only.

References

1. Khavinson VK, Linkova NS, Tarnovskaya SI. Short peptides regulate gene expression. Bull Exp Biol Med. 2014;156(6):737–743.
2. Anisimov VN, Khavinson VK. Peptide bioregulation of aging: results and prospects. Biogerontology. 2010;11(2):139–149.

---

This article is provided for educational and research purposes only. Vesugen is a research peptide. It is not currently FDA-approved and is not intended for human consumption, diagnosis, treatment, cure, or prevention of any disease or condition. The supporting literature is concentrated in a single research programme and independent validation is limited. All work involving this peptide should be conducted by qualified personnel within an appropriate research setting and in compliance with applicable institutional and regulatory requirements.

Vesilute: A Khavinson Dipeptide Bioregulator

Research summary. Vesilute is a short dipeptide (Glu-Asp) developed within the Khavinson "peptide bioregulator" research programme in St. Petersburg, Russia. Within that framework, it is described as having organotropic activity for the urinary bladder and prostate, with reported effects on smooth-muscle tone, microcirculation, and tissue homeostasis in genitourinary tissues. As with the wider Khavinson bioregulator family, the supporting literature is concentrated within the originating Russian research programme, and independent Western validation is limited. Researchers should treat reported effects as hypothesis-generating and weigh them against the broader replication landscape.

Molecular profile

• Sequence: Glu-Asp (EN; H-Glu-Asp-OH)
• Molecular formula: C₉H₁₄N₂O₇
• Molecular weight: ~262.2 g/mol
• Class: Khavinson short-chain peptide bioregulator (cytomedine family)
• Reported tissue tropism: Urinary bladder and prostate

Mechanism of action

The mechanistic framework proposed within the Khavinson research programme for short-chain bioregulators including Vesilute centres on:

• Direct DNA / chromatin interaction. Khavinson and colleagues have proposed that short peptides interact with specific DNA sequences and modulate gene expression in a tissue-specific manner.
• Tissue-specific gene-expression modulation. Within this framework, each bioregulator is reported to act preferentially on the tissue from which it was originally isolated — bladder and prostate tissue in the case of Vesilute.
• Reported smooth-muscle and microcirculatory effects. The Russian research programme reports relaxation of smooth muscle in the bladder wall and improvements in microcirculation in prostate tissue.

The general "short-peptide → DNA / gene-expression" model proposed for the Khavinson bioregulator class has not been broadly replicated outside the originating research programme, and standard pharmacology (receptor identification, structure–activity relationships, independent in vitro reproductions) is not well established for these short dipeptides and tripeptides.

Preclinical and applied research

Bladder and lower-urinary-tract function. Within the Khavinson programme, Vesilute has been reported to influence bladder smooth-muscle tone and to be of interest in age-related lower-urinary-tract conditions.

Prostate research. Reported effects on prostate microcirculation and tissue homeostasis are described within the same programme, with proposed relevance to age-related prostate enlargement.

Reproductive parameters. Russian research has reported effects of cytomedine peptides — including Vesilute — on sperm production and sperm quality in animal models.

Independent validation. Independent Western preclinical or clinical replication of these specific findings is limited. The Glu-Asp dipeptide has also been characterised in food-chemistry contexts (it is one of several umami-active dipeptides), which is unrelated to the bioregulator framework.

Current research status

Vesilute is not approved by any major Western regulator (FDA, EMA, MHRA) for any indication. It is supplied as a research-grade peptide where available and is not intended for self-administration. Researchers working with this peptide should approach it as an investigational research material, recognise the limited independent literature, and design experiments with appropriate vehicle controls and orthogonal endpoints.

Key takeaways for researchers

• Vesilute is a Glu-Asp dipeptide developed within the Khavinson bioregulator research programme.
• Within that framework, it is described as organotropic for bladder and prostate tissue, with reported effects on smooth-muscle tone and microcirculation.
• Supporting literature is concentrated in the originating Russian research programme; independent Western validation of the underlying mechanistic model is limited.
• It is not FDA-approved and is supplied as a research-grade peptide for laboratory use only.

References

1. Khavinson VK, Malinin VV. Gerontological Aspects of Genome Peptide Regulation. Karger, 2005.
2. Khavinson VK, Linkova NS, Tarnovskaya SI. Short peptides regulate gene expression. Bull Exp Biol Med. 2014;156(6):737–743.

---

This article is provided for educational and research purposes only. Vesilute is a research peptide. It is not currently FDA-approved and is not intended for human consumption, diagnosis, treatment, cure, or prevention of any disease or condition. The supporting literature is concentrated in a single research programme and independent validation is limited. All work involving this peptide should be conducted by qualified personnel within an appropriate research setting and in compliance with applicable institutional and regulatory requirements.

Vasoactive Intestinal Peptide (VIP): A 28-Residue Class B GPCR Ligand

Research summary. Vasoactive intestinal peptide (VIP) is a 28-residue endogenous neuropeptide first isolated from porcine intestine in 1970 by Said and Mutt. It is a member of the secretin/glucagon peptide superfamily and signals primarily through the class B G protein-coupled receptors VPAC1 and VPAC2 (and, with lower affinity, the related PAC1 receptor shared with PACAP). VIP is widely distributed across the gastrointestinal tract, central and peripheral nervous systems, immune cells, and pulmonary and cardiovascular tissues, and has been studied across an unusually broad range of research areas — vasodilation, smooth-muscle relaxation, immunomodulation toward Th2-skewed responses, neuroprotection, and circadian-rhythm regulation in the suprachiasmatic nucleus. Multiple VIP analogues and PACAP/VIP-receptor agents have been investigated clinically.

Molecular profile

• Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
• Molecular formula: C₁₄₇H₂₃₇N₄₃O₄₃S
• Molecular weight: ~3326 g/mol
• PubChem CID: 44567960
• CAS number: 37221-79-7
• Human gene: VIP (chromosome 6q25.2)
• Class: Secretin/glucagon-superfamily neuropeptide
• Synonyms: Vasoactive intestinal polypeptide

Mechanism of action

VIP signals through three related class B GPCRs:

• VPAC1 (VIPR1). Broadly distributed (lung, intestine, T cells, brain); generally couples to Gαs and elevates cAMP. Mediates vasodilation, smooth-muscle relaxation, and many immunomodulatory effects.
• VPAC2 (VIPR2). Highly expressed in the suprachiasmatic nucleus, smooth muscle, and immune cells; central to circadian-rhythm regulation and bronchial smooth-muscle relaxation.
• PAC1. Shared with the related peptide PACAP; VIP binds with lower affinity than PACAP but contributes to neuronal effects in some contexts.
• Anti-inflammatory bias. VIP signalling on immune cells skews dendritic-cell maturation, T-cell differentiation, and macrophage activation toward tolerogenic and Th2-type profiles, with associated reductions in pro-inflammatory cytokine output.
• Short plasma half-life. Native VIP has a half-life on the order of minutes, motivating extensive analogue and formulation research.

Preclinical and clinical research highlights

Vasodilation and smooth-muscle relaxation. VIP produces vasodilation, bronchial smooth-muscle relaxation, and gastrointestinal smooth-muscle relaxation — the activity profile that gave it its name.

Pulmonary research. VIP and inhaled VIP analogues have been investigated in pulmonary arterial hypertension, asthma, and sarcoidosis research, with multiple early- and mid-stage clinical-trial programmes in pulmonary hypertension.

Inflammatory bowel disease models. Preclinical research has reported attenuated colitis severity and reduced Th1 cytokine output in murine models of IBD treated with VIP or VIP-derived peptides.

Neuroprotection and CNS research. VIP and the related peptide PACAP have been studied in models of Alzheimer's disease, Parkinson's disease, and ischemic CNS injury, with reported reductions in neuroinflammation and beta-amyloid-related markers, mediated through VPAC1/VPAC2 signalling and downstream secretion of neurotrophic factors including ADNP.

Transplant immunology. Preclinical research has examined VIP for induction of tolerogenic dendritic cells and reduction of acute-rejection markers in transplant models.

Cardiac fibrosis models. Rodent studies have reported VIP effects on cardiac extracellular-matrix remodelling, including reduced angiotensin-receptor expression, in models of cardiac fibrosis.

Circadian rhythm. VIP–VPAC2 signalling in the suprachiasmatic nucleus is essential for synchronisation of the central circadian pacemaker, and Vipr2-null and Vip-null mice show profound circadian-rhythm disruption.

Current research status

Native VIP is not FDA-approved for any indication. Inhaled and modified VIP analogues have been investigated clinically for pulmonary indications, and broader VPAC1/VPAC2 receptor pharmacology remains an active area of drug discovery. Research-grade VIP is supplied for laboratory use only.

Key takeaways for researchers

• VIP is a 28-residue endogenous neuropeptide of the secretin/glucagon superfamily that signals through VPAC1, VPAC2, and (with lower affinity) PAC1 receptors.
• Its biological profile spans vasodilation, smooth-muscle relaxation, anti-inflammatory and Th2-biased immunomodulation, neuroprotection, and circadian-rhythm regulation in the SCN.
• Multiple VIP analogues have been investigated in pulmonary indications, but no native-VIP product is currently FDA-approved.
• The very short plasma half-life of native VIP is the dominant constraint on therapeutic translation and motivates ongoing analogue research.
• Research-grade VIP is supplied for laboratory use only.

References

1. Said SI, Mutt V. Polypeptide with broad biological activity: isolation from small intestine. Science. 1970;169(3951):1217–1218.
2. Delgado M, Ganea D. Vasoactive intestinal peptide: a neuropeptide with pleiotropic immune functions. Amino Acids. 2013;45(1):25–39.

---

This article is provided for educational and research purposes only. VIP is a research peptide. It is not currently FDA-approved and is not intended for human consumption, diagnosis, treatment, cure, or prevention of any disease or condition. All work involving this peptide should be conducted by qualified personnel within an appropriate research setting and in compliance with applicable institutional and regulatory requirements.

Triptorelin: A Synthetic GnRH Decapeptide Agonist

Research summary. Triptorelin is a synthetic decapeptide analogue of gonadotropin-releasing hormone (GnRH) in which the natural glycine at position 6 is replaced by D-tryptophan, producing a long-acting agonist of the GnRH receptor. Continuous (non-pulsatile) administration produces an initial flare followed by sustained suppression of pituitary luteinizing hormone (LH) and follicle-stimulating hormone (FSH) release, leading to suppression of gonadal sex-steroid production. Triptorelin is approved in many jurisdictions for advanced prostate cancer (as part of androgen-deprivation strategies), endometriosis, central precocious puberty, and as a fertility-preservation adjunct, marketed under brand names including Decapeptyl and Trelstar. It is one of the longest-established peptide therapeutics in clinical use.

Molecular profile

• Sequence: Pyr-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH₂
• Molecular formula: C₆₄H₈₂N₁₈O₁₃
• Molecular weight: ~1311.5 g/mol
• PubChem CID: 25074470
• CAS number: 57773-63-4
• Class: GnRH receptor agonist (superagonist)
• Synonyms: D-Trp⁶-LHRH; Decapeptyl; Trelstar

Mechanism of action

Triptorelin acts at the pituitary GnRH receptor (GnRHR), a class A GPCR expressed on gonadotrophs:

• Initial agonism and flare. A single dose stimulates LH and FSH release, producing a transient surge in testosterone (males) or estradiol (females).
• Receptor downregulation under continuous exposure. Unlike the natural pulsatile GnRH signal, sustained occupancy of GnRHR produces receptor desensitisation and downregulation, leading to suppression of LH/FSH output and, secondarily, suppression of gonadal sex-steroid production.
• Pulsatile vs. continuous administration. Pulsatile delivery can preserve gonadotrophin release and has been used in fertility research; depot formulations producing sustained exposure produce the chemical-castration effect that underlies the oncology and endometriosis applications.
• D-Trp⁶ stabilisation. The D-amino acid substitution at position 6 increases resistance to enzymatic degradation, extending half-life relative to native GnRH.

Clinical research highlights

Advanced prostate cancer. Triptorelin is widely used as a component of androgen-deprivation therapy in advanced and metastatic prostate cancer. Suppression of testicular testosterone production reduces growth signalling for hormone-dependent prostate tumour cells. Initial flare is typically managed with concomitant anti-androgen administration.

Premenopausal hormone-receptor-positive breast cancer. GnRH-agonist ovarian suppression with triptorelin has been studied in combination with tamoxifen or aromatase inhibitors in premenopausal women with hormone-receptor-positive breast cancer.

Endometriosis. Sustained suppression of estradiol with triptorelin reduces ectopic endometrial-tissue activity and has been used to manage endometriosis-associated pain and lesion volume, including in pre-surgical settings.

Central precocious puberty. Triptorelin depot formulations are approved for central precocious puberty in children, suppressing premature pubertal progression.

Fertility preservation in chemotherapy. GnRH-agonist co-administration during gonadotoxic chemotherapy has been studied as a strategy to reduce premature ovarian insufficiency, with a substantial body of clinical-trial evidence on this question.

Provocative testing. Single-dose triptorelin has been used as a provocative test of pituitary–gonadal axis function in research and endocrine-evaluation contexts.

Current research status

Triptorelin is approved in the U.S. (Trelstar) and many other jurisdictions for advanced prostate cancer, with broader approvals for endometriosis and central precocious puberty in Europe and elsewhere. It is one of several GnRH-agonist analogues (alongside leuprolide, goserelin, and buserelin) in established clinical use. Where supplied for research, triptorelin is provided as a research-grade peptide and is not intended for self-administration.

Key takeaways for researchers

• Triptorelin is a synthetic D-Trp⁶-substituted GnRH decapeptide that acts as a long-acting GnRHR agonist.
• Continuous administration produces an initial gonadotrophin flare followed by sustained suppression of LH/FSH and gonadal sex steroids — the basis for its oncology and endometriosis applications.
• It is FDA-approved for advanced prostate cancer (Trelstar) and approved in other jurisdictions for additional indications including endometriosis and central precocious puberty.
• The D-amino acid substitution at position 6 increases enzymatic stability relative to native GnRH.
• Outside of approved medical use, triptorelin research material is supplied for laboratory use only.

References

1. Conn PM, Crowley WF Jr. Gonadotropin-releasing hormone and its analogs. Annu Rev Med. 1994;45:391–405.
2. Lepor H. Comparison of single-agent androgen suppression for advanced prostate cancer. Rev Urol. 2005;7 Suppl 5:S3–S12.

---

This article is provided for educational and research purposes only. Triptorelin is a prescription medication where approved; outside of approved medical use, triptorelin research material is supplied for laboratory use only and is not intended for human consumption, diagnosis, treatment, cure, or prevention of any disease or condition. All work involving this peptide should be conducted by qualified personnel within an appropriate research setting and in compliance with applicable institutional and regulatory requirements.

Triblend (BPC-157 / TB-500 / KPV): A Research Peptide Combination for Tissue-Repair Models

Research summary. A "triblend" of BPC-157, TB-500 (thymosin beta-4), and KPV is a research-grade preparation combining three peptides commonly used in tissue-repair and inflammation research. The pharmacological rationale is that the three components act through distinct, non-overlapping mechanisms — angiogenesis and gut-mucosal protection (BPC-157), actin-cytoskeleton-mediated cell migration (TB-500), and α-MSH-derived anti-inflammatory signalling (KPV) — that may produce complementary effects in research models of injury, inflammation, and repair. None of the three components is FDA-approved, and TB-500 is prohibited by WADA in competitive sport. For full mechanism, evidence base, and regulatory status of each component, see the individual peptide entries.

Composition

A typical research triblend contains:

• BPC-157 — a synthetic 15-residue stable gastric pentadecapeptide derived from a fragment of human gastric juice protein. Studied for tissue-repair, gastrointestinal-protection, and angiogenesis endpoints. See the individual BPC-157 post for full molecular and mechanistic detail.
• TB-500 (Thymosin beta-4) — a 43-residue actin-sequestering peptide present in essentially all mammalian cells. Studied for cardiac, dermal, ocular, and musculoskeletal repair endpoints. WADA-prohibited. See the individual TB-500 post for full molecular and mechanistic detail.
• KPV — the Lys-Pro-Val tripeptide corresponding to the C-terminal of α-melanocyte-stimulating hormone, retaining most of the parent hormone's anti-inflammatory activity without the pigmentation effects. Studied predominantly in inflammation and IBD-type research models. See the individual KPV post for full molecular and mechanistic detail.

Mechanistic rationale for combination

The three components act through fundamentally distinct mechanisms:

• BPC-157. Reported effects centre on cytoprotection, angiogenesis (via VEGF and NO pathways), and gastrointestinal-mucosal preservation. Administration routes and tissue-targeting differ from the other components.
• TB-500. Acts via G-actin sequestration and cytoskeletal-remodelling support, with downstream effects on cell migration, angiogenesis, and tissue repair. Distinct from BPC-157 mechanistically despite overlapping endpoints in some preclinical models.
• KPV. Acts via melanocortin-receptor and intracellular pathways shared with α-MSH, producing anti-inflammatory effects through suppression of NF-κB and other inflammation-signalling pathways. Anti-inflammatory rather than tissue-architectural in mechanism.

In principle, the combination provides anti-inflammatory cover (KPV) alongside two complementary tissue-repair / angiogenesis mechanisms (BPC-157, TB-500). Direct published research on three-component blends as a single preparation is limited; most published combination data uses pairs or single agents.

Research considerations for blends

Component-source verification. Researchers using a blend should verify the identity, purity, and concentration of each component independently where possible.

Dosing-protocol literature. Most published research on the three components uses them administered separately. Direct published research on triblends is essentially absent; researchers may need to extrapolate from individual-component literature.

Regulatory framing. None of the three components is FDA-approved. TB-500 is WADA-prohibited; researchers working in athletic-performance contexts should be aware.

Mechanistic interpretation. Reported effects in triblend-administering research are difficult to attribute to specific components without independent dose-titration data, which is typically lacking.

Current research status

A BPC-157 / TB-500 / KPV triblend is an investigational research preparation. None of the three components is FDA-approved, and the combined preparation is not a registered pharmaceutical product. Research-grade triblend material is supplied for laboratory use only and is not intended for self-administration.

Key takeaways for researchers

• The triblend combines three peptides with distinct mechanisms: BPC-157 (cytoprotection / angiogenesis), TB-500 (actin-cytoskeleton-mediated cell migration), and KPV (α-MSH-derived anti-inflammatory signalling).
• The pharmacological rationale is mechanistic complementarity in tissue-repair and inflammation-modulation research models.
• Direct published research on three-component blends is essentially absent; available evidence comes predominantly from individual-component or pairwise-combination studies.
• None of the three components is FDA-approved; TB-500 is WADA-prohibited in competitive sport.
• For full detail on each component, see the individual BPC-157, TB-500, and KPV posts in this collection.

References

1. Sikiric P, Seiwerth S, Rucman R, et al. Stable gastric pentadecapeptide BPC 157: novel therapy in gastrointestinal tract. Curr Pharm Des. 2011;17(16):1612–1632.
2. Goldstein AL, Hannappel E, Sosne G, Kleinman HK. Thymosin β4: a multi-functional regenerative peptide. Expert Opin Biol Ther. 2012;12(1):37–51.

---

This article is provided for educational and research purposes only. The BPC-157 / TB-500 / KPV triblend is a research-grade investigational preparation. It is not an approved drug or therapeutic agent and is not intended for human consumption, diagnosis, treatment, cure, or prevention of any disease or condition. TB-500 is prohibited by the World Anti-Doping Agency in competitive sport. All work involving this preparation should be conducted by qualified personnel within an appropriate research setting and in compliance with applicable institutional and regulatory requirements.

Tirzepatide: A GIP / GLP-1 Dual Receptor Agonist

Research summary. Tirzepatide is a once-weekly synthetic peptide developed by Eli Lilly that acts as a dual agonist at the gastric inhibitory polypeptide (GIP) receptor and the GLP-1 receptor. It was approved by the FDA in 2022 as Mounjaro for type 2 diabetes and in 2023 as Zepbound for chronic weight management, becoming the first GIP/GLP-1 dual agonist to reach the market. Tirzepatide produced larger reductions in HbA1c and body weight than GLP-1 monoagonists in head-to-head trials and represents a substantial pharmacological step beyond the GLP-1 monoagonist class.

Molecular profile

• Class: GIP / GLP-1 dual receptor agonist (peptide)
• Sequence: 39-residue peptide with C20 fatty-diacid conjugation at Lys20, several Aib substitutions, and balanced GIP/GLP-1 receptor engagement
• Molecular formula: C₂₂₅H₃₄₈N₄₈O₆₈
• Molecular weight: ~4813.5 g/mol
• PubChem CID: 156588324
• CAS number: 2023788-19-2
• Synonyms: LY3298176; Mounjaro (T2D brand); Zepbound (obesity brand)
• Half-life: Approximately five days, supporting once-weekly subcutaneous dosing

Mechanism of action

Tirzepatide combines two complementary incretin mechanisms in a single peptide:

• GLP-1 receptor agonism. Glucose-dependent insulin secretion, glucagon suppression, delayed gastric emptying, and central appetite suppression — the established GLP-1 mechanism shared with semaglutide and liraglutide.
• GIP receptor agonism. Additional glucose-dependent insulin release and effects on adipose-tissue insulin sensitivity. The role of GIP receptor agonism in tirzepatide's superior weight-loss profile has been an active area of mechanistic investigation, with the receptor's activity in CNS appetite regulation and in adipose-tissue lipid handling both implicated.
• GIP-favoured affinity. Tirzepatide binds GIP receptor with affinity comparable to native GIP and GLP-1 receptor with somewhat lower affinity than native GLP-1. The "imbalanced" receptor engagement is believed to contribute to the favourable efficacy-and-tolerability profile.
• Fatty-diacid conjugation. The C20 fatty-diacid conjugation supports albumin binding and substantially extends plasma half-life, enabling once-weekly subcutaneous dosing.

Clinical research highlights

SURPASS programme (T2D). Phase 3 SURPASS trials demonstrated tirzepatide's efficacy in type 2 diabetes. In SURPASS-2 (Frías et al., NEJM 2021), tirzepatide produced HbA1c reductions of 2.0–2.3 percentage points versus 1.9 for semaglutide 1 mg, with greater weight loss across all tirzepatide doses. SURPASS-1 through SURPASS-5 supported the FDA approval of Mounjaro in 2022.

SURMOUNT programme (obesity). SURMOUNT-1 (Jastreboff et al., NEJM 2022) reported placebo-subtracted weight reductions of 17.8% at the 15 mg dose in adults with obesity over 72 weeks — substantially exceeding GLP-1 monoagonist comparators. SURMOUNT-2 in T2D-with-obesity, SURMOUNT-3 in continued-weight-loss extension, and SURMOUNT-4 in maintenance-of-weight-loss supported the FDA approval of Zepbound in 2023.

SURMOUNT-OSA. A trial in obstructive sleep apnoea reported substantial reductions in apnoea-hypopnoea index with tirzepatide in adults with obesity and moderate-to-severe OSA, supporting an FDA label expansion for OSA in 2024.

Cardiovascular outcomes (SURPASS-CVOT). A long-term cardiovascular outcomes trial comparing tirzepatide to dulaglutide is ongoing.

Adverse-effect profile. Adverse effects in clinical trials have been broadly consistent with the incretin-agonist class, dominated by gastrointestinal effects (nausea, diarrhoea, vomiting) particularly during dose escalation.

Current research status

Tirzepatide is FDA-approved as Mounjaro (2022) for type 2 diabetes and as Zepbound (2023) for chronic weight management, with subsequent label expansion for obstructive sleep apnoea (2024). It is administered via once-weekly subcutaneous injection.

Research-peptide supply of tirzepatide is broadly available, but the regulated drug product is the appropriate channel for clinical use. Research-grade material is for laboratory and animal-model use only.

Key takeaways for researchers

• Tirzepatide is a once-weekly GIP / GLP-1 dual receptor agonist developed by Eli Lilly.
• It is FDA-approved as Mounjaro (2022, T2D), Zepbound (2023, obesity), and with label expansion for obstructive sleep apnoea (2024).
• Phase 3 results reported HbA1c reductions exceeding 2 percentage points and placebo-subtracted weight reductions of approximately 18% at the highest dose, exceeding GLP-1 monoagonist comparators.
• The GIP-receptor mechanism contributes meaningfully to the differentiated efficacy profile.
• Research-grade tirzepatide is for laboratory use only and is not a substitute for the regulated drug product.

References

1. Frías JP, Davies MJ, Rosenstock J, et al. Tirzepatide versus semaglutide once weekly in patients with type 2 diabetes. N Engl J Med. 2021;385(6):503–515.
2. Jastreboff AM, Aronne LJ, Ahmad NN, et al. Tirzepatide once weekly for the treatment of obesity. N Engl J Med. 2022;387(3):205–216.

---

This article is provided for educational and research purposes only. Tirzepatide research material is supplied for laboratory use and is not intended for human consumption outside of approved, regulated drug products (Mounjaro, Zepbound). It is not intended for diagnosis, treatment, cure, or prevention of any disease or condition. All work involving this peptide should be conducted by qualified personnel within an appropriate research setting and in compliance with applicable institutional and regulatory requirements.

Thyrotropin-Releasing Hormone (TRH / Protirelin): A Hypothalamic Tripeptide

Research summary. Thyrotropin-releasing hormone (TRH), also known by its synthetic-equivalent INN protirelin, is a hypothalamic tripeptide that triggers release of thyroid-stimulating hormone (TSH) and prolactin from the anterior pituitary. It is one of the smallest biologically active peptides — Pyr-His-Pro-NH₂, a single tripeptide modified at both termini (pyroglutamate at the N-terminus and amide at the C-terminus). Synthetic protirelin was historically used clinically as a provocative test of pituitary TSH reserve. Beyond its endocrine role, TRH has been studied across a remarkable breadth of central-nervous-system endpoints, including reported antidepressant, neuroprotective, and arousal-supporting effects. The very short plasma half-life of TRH (minutes) constrains its therapeutic application.

Molecular profile

• Sequence: Pyr-His-Pro-NH₂ (pyroglutamyl-histidyl-proline amide)
• Molecular formula: C₁₆H₂₂N₆O₄
• Molecular weight: ~362.4 g/mol
• PubChem CID: 638678
• CAS number: 24305-27-9
• Class: Hypothalamic releasing-hormone tripeptide
• Synonyms: Protirelin; TRF (thyrotropin-releasing factor); TRH

Mechanism of action

TRH acts via the TRH receptor (TRHR), a class A GPCR with two characterised subtypes:

• TRHR1 in the anterior pituitary. Activates phospholipase C signalling in pituitary thyrotrophs, triggering rapid TSH release; secondary effects include prolactin release from lactotrophs.
• TRHR2 in the central nervous system. Distributed across multiple CNS regions including hippocampus, cerebellum, and brainstem; involved in reported CNS effects on mood, arousal, motor function, and neuroprotection.
• Rapid degradation. TRH is rapidly cleaved by pyroglutamyl aminopeptidase II in plasma and tissues, producing a half-life on the order of minutes — the practical constraint on systemic-administration research models.
• Direct CNS effects independent of TSH-axis. A substantial body of CNS research focuses on direct TRH effects on neurons, separate from its endocrine pituitary role.

Preclinical and clinical research highlights

TSH-reserve diagnostic use. The classical clinical role of TRH was as a provocative test of pituitary TSH reserve, exploiting its rapid stimulation of TSH release from functioning thyrotrophs. This use has largely been displaced by sensitive TSH assays.

Depression and suicidality. Early research dating to the 1970s reported antidepressant effects of intrathecal and intravenous TRH administration in severely depressed patients, with reductions in depressive symptoms and suicidal ideation in a subset of subjects. The very short half-life has been a persistent obstacle to clinical translation, and intranasal TRH formulations have been investigated as potential workarounds.

Bipolar depression chronotherapy. Reports of nocturnal TRH administration producing extended antidepressant effects (up to 48 hours) align with the natural circadian rhythm of TRH and have been a focus of chronotherapy-oriented research.

Motor learning and cerebellar function. Research has reported TRH effects on motor learning and cerebellar function, with the highest TRH-receptor density in the central nervous system being in the cerebellum.

Neuroprotection. TRH has been studied in spinal-cord injury, traumatic brain injury, and neurodegenerative-disease models, with reported neuroprotective effects across multiple paradigms.

Other physiological effects. Reported effects span autonomic regulation, arousal, feeding behaviour, and antioxidant activity, consistent with the wide CNS distribution of TRHR2.

Current research status

Synthetic TRH (protirelin) was historically marketed for diagnostic use; current commercial availability varies by jurisdiction. Several formulations have been investigated for clinical translation of CNS effects, but no broad CNS indication is currently FDA-approved. Research-grade TRH is supplied for laboratory use only.

For research-supplier contexts, TRH / protirelin is supplied as a research-grade peptide and is not intended for self-administration.

Key takeaways for researchers

• TRH / protirelin is a hypothalamic tripeptide (Pyr-His-Pro-NH₂) with both endocrine (pituitary TSH/prolactin release) and direct CNS effects.
• The very short plasma half-life of minutes is the dominant practical constraint on therapeutic translation.
• Research interest spans antidepressant effects, motor learning and cerebellar function, neuroprotection in CNS injury models, and autonomic and arousal regulation.
• TRH was historically used as a TSH-reserve diagnostic; broader CNS clinical applications have not achieved FDA approval.
• Research-grade TRH is for laboratory use only.

References

1. Gary KA, Sevarino KA, Yarbrough GG, Prange AJ Jr, Winokur A. The thyrotropin-releasing hormone (TRH) hypothesis of homeostatic regulation: implications for TRH-based therapeutics. J Pharmacol Exp Ther. 2003;305(2):410–416.
2. Marangell LB, George MS, Callahan AM, Ketter TA, Pazzaglia PJ, L'Herrou TA, Leverich GS, Post RM. Effects of intrathecal thyrotropin-releasing hormone (protirelin) in refractory depressed patients. Arch Gen Psychiatry. 1997;54(3):214–222.

---

This article is provided for educational and research purposes only. TRH / protirelin is a research peptide. It is not currently FDA-approved for broad therapeutic use and is not intended for human consumption, diagnosis, treatment, cure, or prevention of any disease or condition. All work involving this peptide should be conducted by qualified personnel within an appropriate research setting and in compliance with applicable institutional and regulatory requirements.

Thymosin Alpha-1 (Thymalfasin): A 28-Residue Immunomodulatory Thymic Peptide

Research summary. Thymosin alpha-1 is a 28-amino-acid immunomodulatory peptide originally isolated from the thymus by Allan Goldstein and colleagues in the 1970s. Its synthetic equivalent, thymalfasin, has been used clinically for decades across more than thirty countries (though not in the United States) as an immunomodulator in chronic hepatitis B and hepatitis C, in immunocompromised vaccine-response contexts, and in adjunctive cancer immunotherapy. Thymosin alpha-1 acts on dendritic-cell and T-cell signalling — predominantly via TLR-engagement-related mechanisms — to support coordinated host-defence and immune-regulation programmes. It drew renewed research attention during the COVID-19 pandemic for its reported effects on immune dysregulation in severe viral illness.

Molecular profile

• Sequence: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn (28 residues, N-terminally acetylated)
• Molecular formula: C₁₂₉H₂₁₅N₃₃O₅₅
• Molecular weight: ~3108.3 g/mol
• Class: Immunomodulatory thymic peptide (proteolytic fragment of prothymosin alpha)
• Synonyms: Thymalfasin; Zadaxin (brand); Tα1
• Approval status: Approved in 35+ countries for chronic hepatitis B and chronic hepatitis C (often in combination with interferon-α); not FDA-approved in the United States

Mechanism of action

Thymosin alpha-1 acts as a multi-pathway immunomodulator rather than as a stimulant of any single immune lineage:

• TLR-engagement-related signalling. Reported across in-vitro work; thymosin alpha-1 has been described as engaging TLR2 and TLR9 pathways on dendritic cells and other innate-immune cell types, with downstream effects on cytokine production and T-cell priming.
• Dendritic-cell maturation. Reported effects on dendritic-cell phenotype and antigen-presentation capacity, supporting downstream T-cell activation.
• T-cell function. Reported effects on T-cell maturation, on the Th1/Th2 cytokine balance, and on regulatory T-cell populations.
• NK-cell activity. Reported increases in natural-killer-cell cytotoxic activity in some research models, contributing to the reported antiviral and anti-tumour effects.
• Restoration rather than stimulation. The published mechanistic framing emphasises restoration of normal immune function in dysregulated or immunocompromised states, rather than supraphysiological immune activation.

Preclinical and clinical research highlights

Chronic hepatitis B. Multiple Phase 3 and post-marketing studies have reported that thymosin alpha-1, particularly in combination with interferon-α, is associated with improved virological-response and seroconversion endpoints in chronic hepatitis B.

Chronic hepatitis C. Similar combination-therapy data have reported improved sustained-virological-response rates with thymosin alpha-1 plus interferon-α versus interferon-α monotherapy, particularly in interferon-resistant populations.

Adjuvant cancer immunotherapy. Thymosin alpha-1 has been studied across multiple cancer types (melanoma, hepatocellular carcinoma, non-small-cell lung cancer) as an adjunct to chemotherapy or immune-checkpoint approaches, with reported improvements in immune-recovery and survival endpoints in some trials.

Vaccine response. Reported effects in immunocompromised populations (haemodialysis, elderly) include improved antibody-response rates to influenza and hepatitis-B vaccinations.

COVID-19 research. Observational studies during the COVID-19 pandemic — predominantly from China and Italy — reported that thymosin alpha-1 administration was associated with reduced mortality in severe cases, attributed to its reported effects on immune-dysregulation endpoints. These observational data are not the basis for any approved indication.

Sepsis and critical illness. Thymosin alpha-1 has been studied in sepsis-related immune dysfunction, with reported improvements in immune-recovery and short-term-mortality endpoints in some randomised trials.

Current research status

Thymosin alpha-1 / thymalfasin is approved in 35+ countries (notably Italy, China, and others) as a prescription immunomodulator, primarily for chronic hepatitis B and C. It is not FDA-approved in the United States. Research-grade thymosin alpha-1 is supplied for laboratory use only.

For research-supplier contexts, thymosin alpha-1 is supplied as a research-grade investigational peptide and is not intended for self-administration.

Key takeaways for researchers

• Thymosin alpha-1 is a 28-residue immunomodulatory thymic peptide with decades of published clinical research.
• The mechanism is multi-pathway immunomodulation via TLR-engagement-related signalling, dendritic-cell maturation support, and Th1/Th2 balance modulation.
• It is approved in 35+ countries for chronic hepatitis B and C; it is not FDA-approved in the United States.
• Reported applications include chronic hepatitis, adjuvant cancer immunotherapy, vaccine-response support in immunocompromised populations, sepsis, and (observationally) severe COVID-19.
• Research-grade thymosin alpha-1 is for laboratory use only.

References

1. Goldstein AL, Low TL, McAdoo M, McClure J, Thurman GB, Rossio J, Lai CY, Chang D, Wang SS, Harvey C, Ramel AH, Meienhofer J. Thymosin alpha1: isolation and sequence analysis of an immunologically active thymic polypeptide. Proc Natl Acad Sci USA. 1977;74(2):725–729.
2. Camerini R, Garaci E. Historical review of thymosin α1 in infectious diseases. Expert Opin Biol Ther. 2015;15 Suppl 1:S117–127.

---

This article is provided for educational and research purposes only. Thymosin alpha-1 is a research peptide. It is not an FDA-approved drug in the United States and is not intended for human consumption, diagnosis, treatment, cure, or prevention of any disease or condition. All work involving this peptide should be conducted by qualified personnel within an appropriate research setting and in compliance with applicable institutional and regulatory requirements.

Thymagen (Thymogen): A Khavinson-Family Dipeptide Bioregulator Studied in Immune-Function Models

Research summary. Thymagen, also marketed in Russia under the name Thymogen, is the dipeptide Glu-Trp (EW), the smallest member of the Khavinson "peptide bioregulator" family. It was originally isolated as an active fragment of larger thymic-extract preparations and is now produced synthetically. The published Russian literature reports immunomodulatory effects centred on T-cell function, interferon secretion, and host defence against viral and bacterial pathogens. Thymagen is approved as a prescription immunomodulator in Russia and several CIS countries, though it is not approved by the FDA or EMA. Mechanistic claims regarding direct gene-expression effects in thymic and immune tissues follow the broader Khavinson bioregulator pattern.

Molecular profile

• Sequence: Glu-Trp (EW)
• Class: Khavinson-family dipeptide; immunomodulatory bioregulator
• Synonyms: Thymogen; Glutamyl-tryptophan; γ-Glu-Trp (some preparations)
• Approval status: Approved as a prescription immunomodulator in Russia; not FDA- or EMA-approved
• Origin: Originally derived from calf-thymus extracts, now produced synthetically

Mechanism of action

Thymagen is reported to act through immunomodulatory pathways involving thymic-tissue effects and downstream T-cell function:

• T-cell maturation and function. Reported effects on thymic-tissue gene expression and on T-cell maturation in immune-deficient or thymus-compromised models.
• Interferon secretion. Reported increases in interferon production by immune cells following Thymagen administration, supporting reported antiviral activity.
• Cyclic-nucleotide signalling. The Russian research literature describes Thymagen as modulating intracellular cAMP and cGMP signalling in immune cells, providing a proposed second-messenger mechanism.
• Heterochromatin and gene-expression effects. Consistent with the broader Khavinson bioregulator framework; reported effects include decondensation of heterochromatin in lymphocytes and changes in expression of immune-relevant genes.

The mechanistic picture in the originating literature is of a "thymus-resetting" peptide that supports normal immune function rather than producing supraphysiological immune stimulation.

Preclinical and clinical research highlights

Hepatitis B and C. Russian clinical research has reported that Thymagen administration as adjunctive therapy is associated with improved viral-clearance and clinical-recovery endpoints in hepatitis-B and hepatitis-C infection.

Post-operative infection and recovery. Reported applications include reduction of post-operative infectious complications and improvement of immune-recovery endpoints in surgical-patient populations.

Cancer-adjuvant research. Russian research has explored Thymagen as an immune-supportive adjunct in oncology populations, with reported modulation of innate-immune endpoints.

Cardiovascular and metabolic-disease applications. Some published work has reported effects in cardiovascular disease and diabetes contexts, attributed to the broader systemic effects of immune-system modulation.

Influenza and respiratory infection. Reported effects on antiviral immunity have been investigated in respiratory infection contexts.

Limitations of the evidence base

• The published Thymagen / Thymogen literature is concentrated almost entirely in Russian research groups, with limited independent Western replication.
• Western regulatory approval is absent; clinical evidence does not currently meet FDA or EMA standards for any infectious-disease or oncology indication.
• The very small (dipeptide) size of Thymagen places mechanistic claims in the same conceptual category as other Khavinson bioregulators, where direct-DNA-interaction claims remain debated outside the originating programme.

Current research status

Thymagen / Thymogen is not approved by the FDA or EMA. It is approved as a prescription immunomodulator in Russia. Research-grade Thymagen is supplied for laboratory use only.

For research-supplier contexts, Thymagen is supplied as a research-grade investigational peptide and is not intended for self-administration.

Key takeaways for researchers

• Thymagen / Thymogen is the dipeptide Glu-Trp, the smallest member of the Khavinson bioregulator family.
• Reported mechanisms include T-cell maturation support, interferon secretion induction, cyclic-nucleotide signalling modulation, and gene-expression effects in immune tissues.
• Reported clinical applications in Russian literature include hepatitis B/C, post-operative recovery, cancer-adjuvant research, and respiratory infection.
• Thymagen is approved in Russia but is not FDA- or EMA-approved.
• The published literature is concentrated in the originating Russian research programme; independent Western replication is limited.

References

1. Khavinson VK, Solovyev AY, Tarnovskaya SI, Lin'kova NS. Mechanism of biological activity of short peptides: cell penetration and epigenetic regulation of gene expression. Bull Exp Biol Med. 2014;156(5):635–639.
2. Anisimov VN, Khavinson VK. Peptide bioregulation of aging: results and prospects. Biogerontology. 2010;11(2):139–149.

---

This article is provided for educational and research purposes only. Thymagen / Thymogen is a research peptide. It is not an approved drug or therapeutic agent in the United States or European Union and is not intended for human consumption, diagnosis, treatment, cure, or prevention of any disease or condition. All work involving this peptide should be conducted by qualified personnel within an appropriate research setting and in compliance with applicable institutional and regulatory requirements.